PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008240002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family TCP
Protein Properties Length: 387aa    MW: 42956.9 Da    PI: 7.5177
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008240002.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP98.51.2e-30591863121
             TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssa......sec.eaesssssasnsssg.. 88 
                     g+kdrhsk++T +g+RdRR+Rls+++a++++dLqd+LG+ ++sk i+WLl   +  i++l+ ++ ++       +++ ++++s+ ++++s+++  
  XP_008240002.1  59 GGKDRHSKVSTVRGLRDRRIRLSVPTAIQLYDLQDRLGLSQPSKVIDWLLDVTEDDIDKLPPLQVPHGfahqfhQQMlNPHHSHDQGHQSNNSla 153
                     78*************************************************************55555333232222544555555444444465 PP

             TCP  89 kaaksaakskksqksaasalnlakesrakarar 121
                     +a  ++ +s++ ++++++++ +++++r++ + +
  XP_008240002.1 154 AAPFFDVNSSFMEADHQAHQVVHDHQRSSTSTN 186
                     555566677777777777777777776444433 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.0E-2860205IPR005333Transcription factor, TCP
PROSITE profilePS5136927.88460118IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0045962Biological Processpositive regulation of development, heterochronic
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MISNSREKGF QAKQEGHNNT NNDGNSSNFN KESSSSTTTS RQWSGFRNPR IVRVSRTFGG  60
KDRHSKVSTV RGLRDRRIRL SVPTAIQLYD LQDRLGLSQP SKVIDWLLDV TEDDIDKLPP  120
LQVPHGFAHQ FHQQMLNPHH SHDQGHQSNN SLAAAPFFDV NSSFMEADHQ AHQVVHDHQR  180
SSTSTNVGDR KGKSIKTHDE QDDDDQNHHQ DGNIGGGQLL AQKLFPQGNH PSSIPGLLNN  240
AMAYNYYHNY SEPSSLSLSQ FGGHGFPPVP QIDHHSHMMS NALSFSTSMP SGSQLFFCPS  300
TATPSLFGPY PPYITNPVVE RGTNTSEPRS QANHFQFLSS SNSPNLLPNA LMSSLQSLKS  360
YPTSVNPKQL HSNSQDNNGS QPNKDHN
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00065PBMTransfer from AT5G60970Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008240003.10.0PREDICTED: transcription factor TCP5-like isoform X1
RefseqXP_008240002.10.0PREDICTED: transcription factor TCP5-like isoform X1
TrEMBLM5WBB40.0M5WBB4_PRUPE; Uncharacterized protein
STRINGGLYMA04G32324.12e-93(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF93234119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60970.19e-49TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5